PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01010218001
Common NameVIT_01s0010g01500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 104aa    MW: 11422.1 Da    PI: 11.2502
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01010218001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.33.6e-222164649
                       HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       +sn qvtfskRr g++KKA+ELS+LC+ae a+i+fs+  k+y +
  GSVIVT01010218001 21 ESNLQVTFSKRRSGLFKKASELSTLCGAETAIIVFSPGKKVYSF 64
                       7899**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.577868IPR002100Transcription factor, MADS-box
SMARTSM004326.2E-28867IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.5E-27982IPR002100Transcription factor, MADS-box
CDDcd002652.47E-32978No hitNo description
PRINTSPR004048.6E-191030IPR002100Transcription factor, MADS-box
PfamPF003193.2E-241864IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-193045IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-194566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MATIRKSKGR QRVEMTKMAK ESNLQVTFSK RRSGLFKKAS ELSTLCGAET AIIVFSPGKK  60
VYSFGHPSVE SIVDRFLTRN PLTNAGTLQL FEAHRASNTT NTN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-15980172Myocyte-specific enhancer factor 2A
3kov_B2e-15980172Myocyte-specific enhancer factor 2A
3kov_I2e-15980172Myocyte-specific enhancer factor 2A
3kov_J2e-15980172Myocyte-specific enhancer factor 2A
3p57_A2e-15980172Myocyte-specific enhancer factor 2A
3p57_B2e-15980172Myocyte-specific enhancer factor 2A
3p57_C2e-15980172Myocyte-specific enhancer factor 2A
3p57_D2e-15980172Myocyte-specific enhancer factor 2A
3p57_I2e-15980172Myocyte-specific enhancer factor 2A
3p57_J2e-15980172Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4256961e-155AM425696.2 Vitis vinifera contig VV78X155485.3, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270922.11e-59PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK21e-42AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLD7TAE53e-71D7TAE5_VITVI; Putative uncharacterized protein
STRINGVIT_01s0010g01500.t019e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.16e-44AGAMOUS-like 62